PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA03G04550.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family B3
Protein Properties Length: 169aa    MW: 19453.8 Da    PI: 4.9766
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA03G04550.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B332.81.3e-10941513594
                      EEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
               B3  35 tltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                       ++ +  + +s++++l+ r k++r +lt+GW++  +a+  +egD+++F++++ ++  lv+
  ONIVA03G04550.2  94 LMVSMAGTTQSYQMRLK-RSKDSRAMLTTGWNQLIDAKAFDEGDVCLFHFKEVDD-VLVL 151
                      33334456799999993.4444459************************876433.2444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.6E-974151IPR015300DNA-binding pseudobarrel domain
CDDcd100171.82E-776153No hitNo description
PfamPF023622.2E-880153IPR003340B3 DNA binding domain
SuperFamilySSF1019362.75E-8100151IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508638.713103157IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MGDGNEVIDI SSDSDDGQYG PRTFSGFDKY CWYGNDVTLT KSMHLQIAHV AAVNFAEDST  60
LRVHCQENPY DQCENVQFSE RYINKYIGSP IDDLMVSMAG TTQSYQMRLK RSKDSRAMLT  120
TGWNQLIDAK AFDEGDVCLF HFKEVDDVLV LKITQLRHFF GMHYNYPKY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1044281e-126AC104428.2 Oryza sativa Japonica Group chromosome 3 clone OJ1123F12, complete sequence.
GenBankAK0708451e-126AK070845.1 Oryza sativa Japonica Group cDNA clone:J023070F17, full insert sequence.
GenBankAP0149591e-126AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCP0126111e-126CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0GH761e-127A0A0E0GH76_ORYNI; Uncharacterized protein
STRINGBGIOSGA011927-PA4e-70(Oryza sativa Indica Group)